Loading...
Statistics
Advertisement

www.schmitt.cloud
www.schmitt.cloud/
Hier entsteht schmitt.cloud

Schmitt.cloud

Advertisement
Conversion Technology Metas Server
Schmitt.cloud is hosted in Germany . Schmitt.cloud doesn't use HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Schmitt.cloud

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Schmitt.cloud

Missing HTTPS protocol.

    Meta - Schmitt.cloud

    Number of occurences: 3
    • Name: keywords
      Content: schmitt.cloud
    • Name: description
      Content: Hier entsteht schmitt.cloud
    • Name:
      Content: text/html; charset=UTF-8

    Server / Hosting

    • IP: 89.31.143.1
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns.udag.org
    • ns.udag.net
    • ns.udag.de
    • smx00.udag.de
    • smx01.udag.de

    Target

    • hostmaster.united-domains.de

    HTTP Header Response

    HTTP/1.1 200 OK Date: Mon, 10 Oct 2016 11:52:05 GMT Server: Apache X-UD-Method: vm_wiese Vary: Accept-Encoding Content-Length: 1330 Content-Type: text/html X-Cache: MISS from s_hv1027 Via: 1.1 s_hv1027 (squid/3.5.20) Connection: keep-alive

    DNS

    host: schmitt.cloud
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 89.31.143.1
    host: schmitt.cloud
    1. class: IN
    2. ttl: 259200
    3. type: NS
    4. target: ns.udag.org
    host: schmitt.cloud
    1. class: IN
    2. ttl: 259200
    3. type: NS
    4. target: ns.udag.net
    host: schmitt.cloud
    1. class: IN
    2. ttl: 259200
    3. type: NS
    4. target: ns.udag.de
    host: schmitt.cloud
    1. class: IN
    2. ttl: 604800
    3. type: SOA
    4. mname: ns.udag.de
    5. rname: hostmaster.united-domains.de
    6. serial: 2016021501
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: schmitt.cloud
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: smx00.udag.de
    host: schmitt.cloud
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: smx01.udag.de

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.chmitt.cloud, www.sechmitt.cloud, www.echmitt.cloud, www.swchmitt.cloud, www.wchmitt.cloud, www.sdchmitt.cloud, www.dchmitt.cloud, www.sxchmitt.cloud, www.xchmitt.cloud, www.sfchmitt.cloud, www.fchmitt.cloud, www.sgchmitt.cloud, www.gchmitt.cloud, www.stchmitt.cloud, www.tchmitt.cloud, www.shmitt.cloud, www.scdhmitt.cloud, www.sdhmitt.cloud, www.scrhmitt.cloud, www.srhmitt.cloud, www.scthmitt.cloud, www.sthmitt.cloud, www.scvhmitt.cloud, www.svhmitt.cloud, www.scfhmitt.cloud, www.sfhmitt.cloud, www.scghmitt.cloud, www.sghmitt.cloud, www.schhmitt.cloud, www.shhmitt.cloud, www.scnhmitt.cloud, www.snhmitt.cloud, www.scmhmitt.cloud, www.smhmitt.cloud, www.scjhmitt.cloud, www.sjhmitt.cloud, www.scmitt.cloud, www.schemitt.cloud, www.scemitt.cloud, www.schdmitt.cloud, www.scdmitt.cloud, www.schcmitt.cloud, www.sccmitt.cloud, www.schumitt.cloud, www.scumitt.cloud, www.schjmitt.cloud, www.scjmitt.cloud, www.schmitt.cloud, www.scmitt.cloud, www.schbmitt.cloud, www.scbmitt.cloud, www.schgmitt.cloud, www.scgmitt.cloud, www.schitt.cloud, www.schmpitt.cloud, www.schpitt.cloud, www.schmoitt.cloud, www.schoitt.cloud, www.schmiitt.cloud, www.schiitt.cloud, www.schmkitt.cloud, www.schkitt.cloud, www.schm.itt.cloud, www.sch.itt.cloud, www.schmuitt.cloud, www.schuitt.cloud, www.schmjitt.cloud, www.schjitt.cloud, www.schmnitt.cloud, www.schnitt.cloud, www.schm-itt.cloud, www.sch-itt.cloud, www.schmtt.cloud, www.schmirtt.cloud, www.schmrtt.cloud, www.schmiftt.cloud, www.schmftt.cloud, www.schmivtt.cloud, www.schmvtt.cloud, www.schmiktt.cloud, www.schmktt.cloud, www.schmi,tt.cloud, www.schm,tt.cloud, www.schmibtt.cloud, www.schmbtt.cloud, www.schmigtt.cloud, www.schmgtt.cloud, www.schmittt.cloud, www.schmttt.cloud, www.schmiytt.cloud, www.schmytt.cloud, www.schmiutt.cloud, www.schmutt.cloud, www.schmijtt.cloud, www.schmjtt.cloud, www.schmimtt.cloud, www.schmmtt.cloud, www.schmintt.cloud, www.schmntt.cloud, www.schmit.cloud, www.schmitqt.cloud, www.schmiqt.cloud, www.schmitat.cloud, www.schmiat.cloud, www.schmit t.cloud, www.schmi t.cloud, www.schmitwt.cloud, www.schmiwt.cloud, www.schmitet.cloud, www.schmiet.cloud, www.schmitzt.cloud, www.schmizt.cloud, www.schmitxt.cloud, www.schmixt.cloud, www.schmitct.cloud, www.schmict.cloud, www.schmit.cloud, www.schmittq.cloud, www.schmitq.cloud, www.schmitta.cloud, www.schmita.cloud, www.schmitt .cloud, www.schmit .cloud, www.schmittw.cloud, www.schmitw.cloud, www.schmitte.cloud, www.schmite.cloud, www.schmittz.cloud, www.schmitz.cloud, www.schmittx.cloud, www.schmitx.cloud, www.schmittc.cloud, www.schmitc.cloud,

    Other websites we recently analyzed

    1. plantspearlsparanoia | Growing Seedlings & Other Thoughts
      Provo (United States) - 173.254.14.138
      Server software: nginx/1.8.1
      Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
      Number of Javascript: 1
      Number of meta tags: 2
    2. designertobuyers.com
      Scottsdale (United States) - 50.63.202.44
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    3. SeaMODE Speed Lab
      Gloucester (United Kingdom) - 213.171.218.7
      G Analytics ID: UA-79673652-1
      Server software: nginx
      Technology: CSS, Html, Javascript, Google Analytics
      Number of meta tags: 1
    4. HostingDiscounter De goedkoopste webhoster van nederland
      HostingDiscounter De goedkoopste webhoster van Nederland - Goedkope domeinnaam registratie, Domein hosting met veel diskspace op uw shared of dedicated server
      Netherlands - 77.95.252.42
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 5
    5. Home | Hoveniersbedrijf Slaats | Hovenier, Deurne, Fred Slaats
      Hoveniersbedrijf uit Neerkant bij Deurne, werkzaam in de gehele regio van Noord-Brabant en Limburg. Onze specialiteit is onderhoud en snoeiwerk.
      Netherlands - 149.210.237.177
      Server software: Apache
      Technology: AJAX Libraries API, CSS, Html, Javascript, Add This
      Number of Javascript: 2
      Number of meta tags: 2
    6. Welcome to Gehlin.Com!
      Sweden - 213.180.93.13
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: CSS, Html
      Number of meta tags: 1
    7. tampacriminaldefenselawyer.net
      Wayne (United States) - 216.250.120.114
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    8. 267286.com
      China - 203.195.130.175
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Html5, Iframe, Javascript
      Number of meta tags: 1
    9. Exotic Beads Manufacturer Penang, Georgetown, Ethnic Beads Supplier Malaysia ~ Guo Qiang Sdn Bhd (beadsZONE)
      Guo Qiang Sdn Bhd (beadsZONE) is the largest manufacturer and supplier of ethnic & exotic beads accessories and jewellery in Penang, Malaysia.
      Malaysia - 119.110.102.139
      G Analytics ID: UA-37858188-33
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Javascript, jQuery UI, Php, Google Analytics, Facebook Box
      Number of Javascript: 6
      Number of meta tags: 9
    10. Concern Organization
      Concern Organization is a nongovernmental, nonprofit and nonpolitical organization based in Faisalabad in the province of Punjab – Pakistan. We mainly work
      Houston (United States) - 192.185.46.37
      Server software: nginx/1.10.1
      Technology: CSS, Fancybox, Flexslider, Html, Javascript, jQuery, jQuery Cycle, jQuery UI, Lightbox, Php, Pingback, Shortcodes, SuperFish, Wordpress
      Number of Javascript: 22
      Number of meta tags: 4

    Check Other Websites